Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL226W  from Saccharomyces cerevisiae S288C
>YGL226W|YGL226W MTC3 SGDID:S000003195, Chr VII from 73340-73711, Genome Release 64-1-1, Verified ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the mitochondrion; mtc3 is synthetically sick with cdc13-1" ORGANISM: Saccharomyces cerevisiae S288C (123 aa)
MMGRNGIRLALKRSFSTYQPPVVEITNITKLWPTLRPEVRDEIKEYLRWRMQEDWRHIPL
EETKAAYFLSYGPCGGRSKGNEWNVGYTGMRIVFNLVLFGGAATAFYNWKQDKKLEEQLR
DLV