Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL226C-A  from Saccharomyces cerevisiae S288C
>YGL226C-A|YGL226C-A OST5 SGDID:S000003194, Chr VII from 72988-72749,73158-73138, Genome Release 64-1-1, reverse complement, Verified ORF, "Zeta subunit of the oligosaccharyltransferase complex of the ER lumen, which catalyzes asparagine-linked glycosylation of newly synthesized proteins" ORGANISM: Saccharomyces cerevisiae S288C (86 aa)
MTYEQLYKEFHSSKSFQPFIHLDTQPKFAICGLIVTLAVLSSALFAVGSKSSYIKKLFFY
TILSVIGSLFAGLTTVFASNSFGVYV