Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL220W  from Saccharomyces cerevisiae S288C
>YGL220W|YGL220W FRA2 SGDID:S000003188, Chr VII from 82374-82736, Genome Release 64-1-1, Verified ORF, "Protein involved in negative regulation of transcription of iron regulon; forms an iron independent complex with Fra2p, Grx3p, and Grx4p; null mutant fails to repress iron regulon and is sensitive to nickel" ORGANISM: Saccharomyces cerevisiae S288C (120 aa)
MTGERIEKVKINDEFAKSHFLTTQWRETKRQRHYKMPVTEQGLRERIESAIPQVYHIIVT
DLSYGCGQSFDIVVVSDFFQGKSKLMRSRAVNKAVKEELQEIHAFSCKCYTEEEWSKIVV