Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL194C-A  from Saccharomyces cerevisiae S288C
>YGL194C-A|YGL194C-A YGL194C-A SGDID:S000087160, Chr VII from 139961-139719, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function, identified based on comparisons of the genome sequences of six Saccharomyces species" ORGANISM: Saccharomyces cerevisiae S288C (80 aa)
MSNKEITCIKPFKIIALILLIVLIINLSYKLFLRRYLKSTVIWCLGIANTDRNDMMWWQV
SPLLERWVWQLVDNYESGYE