Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL193C  from Saccharomyces cerevisiae S288C
>YGL193C|YGL193C YGL193C SGDID:S000003161, Chr VII from 142227-141916, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Haploid-specific gene repressed by a1-alpha2, turned off in sir3 null strains, absence enhances the sensitivity of rad52-327 cells to campothecin almost 100-fold" ORGANISM: Saccharomyces cerevisiae S288C (103 aa)
MNSSLNANSYFFRKPPMLTYMVRFLYCYPSPFPIAPAVTDLPECRGDLSLSLFITSFTST
KERTILYAKSRLKTHIPVNLCDRYHYIPKAPLYQCRMPCLYSI