Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL191W  from Saccharomyces cerevisiae S288C
>YGL191W|YGL191W COX13 SGDID:S000003159, Chr VII from 144808-145197, Genome Release 64-1-1, Verified ORF, "Subunit VIa of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain; not essential for cytochrome c oxidase activity but may modulate activity in response to ATP" ORGANISM: Saccharomyces cerevisiae S288C (129 aa)
MFRQCAKRYASSLPPNALKPAFGPPDKVAAQKFKESLMATEKHAKDTSNMWVKISVWVAL
PAIALTAVNTYFVEKEHAEHREHLKHVPDSEWPRDYEFMNIRSKPFFWGDGDKTLFWNPV
VNRHIEHDD