Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YGL188C-A  from Saccharomyces cerevisiae S288C
>YGL188C-A|YGL188C-A YGL188C-A SGDID:S000028635, Chr VII from 148964-148824, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" ORGANISM: Saccharomyces cerevisiae S288C (46 aa)
MLTTQKCESREGKNDEIFELGESNSDKILLKHGKCNLFSERKPVNH