Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL187C  from Saccharomyces cerevisiae S288C
>YGL187C|YGL187C COX4 SGDID:S000003155, Chr VII from 150171-149704, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit IV of cytochrome c oxidase, the terminal member of the mitochondrial inner membrane electron transport chain; precursor N-terminal 25 residues are cleaved during mitochondrial import; phosphorylated; spermidine enhances translation" ORGANISM: Saccharomyces cerevisiae S288C (155 aa)
MLSLRQSIRFFKPATRTLCSSRYLLQQKPVVKTAQNLAEVNGPETLIGPGAKEGTVPTDL
DQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHT
IMWLKPTVNEVARCWECGSVYKLNPVGVPNDDHHH