Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL168W  from Saccharomyces cerevisiae S288C
>YGL168W|YGL168W HUR1 SGDID:S000003136, Chr VII from 187464-187796, Genome Release 64-1-1, Verified ORF, "Protein of unknown function; reported null mutant phenotype of hydroxyurea sensitivity may be due to effects on overlapping PMR1 gene" ORGANISM: Saccharomyces cerevisiae S288C (110 aa)
MFILVSVVNICTYIHLHMFPLISTFTSIGLGVLMKDKGKEGKTIKAQNVTYQTFEKYVES
SSFFFLVHNFLNSSTMKTLLLMSNNNSISEIPSFSVLKILWKNGIYIAHI