Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL127C  from Saccharomyces cerevisiae S288C
>YGL127C|YGL127C SOH1 SGDID:S000003095, Chr VII from 270775-270392, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the RNA polymerase II mediator complex; associates with core polymerase subunits to form the RNA polymerase II holoenzyme; involved in telomere maintenance; conserved with other metazoan MED31 subunits" ORGANISM: Saccharomyces cerevisiae S288C (127 aa)
MSSTNGNAPATPSSDQNPLPTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKY
LEYWCNPPYSQCIVYPNCLFILKLLNGFMESAIVNEDGLLEGLDELPKIIQLQGPQWMNE
MVERWAN