Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL121C  from Saccharomyces cerevisiae S288C
>YGL121C|YGL121C GPG1 SGDID:S000003089, Chr VII from 281157-280777, Genome Release 64-1-1, reverse complement, Verified ORF, "Proposed gamma subunit of the heterotrimeric G protein that interacts with the receptor Gpr1p; involved in regulation of pseudohyphal growth; requires Gpb1p or Gpb2p to interact with Gpa2p; overproduction causes prion curing" ORGANISM: Saccharomyces cerevisiae S288C (126 aa)
MFYLSDIEEEASAGAEPTYNFWEVLLFSNTQENLVTVVGELHTLTDRVVHYKIEPESREV
TATTLPSLLALLLEKRNQARRLYRDVLSMKMSELDWDIDDLFTQLQEELTRTDDTLSMYP
RRRFYH