Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL108C  from Saccharomyces cerevisiae S288C
>YGL108C|YGL108C YGL108C SGDID:S000003076, Chr VII from 304071-303649, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Protein of unknown function, predicted to be palmitoylated; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery" ORGANISM: Saccharomyces cerevisiae S288C (140 aa)
MGLCGSKTQPMPSQTTTVATKARTKPINRDTVKSKQELRHKEKKDKKKKTQLKSTTVPVV
QRKEGSKLTDTSDPSKNKVSPKEAARLAAEKRFQETNEKYNKGELGKKLAQERAKSHKTR
LMEEAEKKHAERERENMIYD