Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL106W  from Saccharomyces cerevisiae S288C
>YGL106W|YGL106W MLC1 SGDID:S000003074, Chr VII from 306560-307009, Genome Release 64-1-1, Verified ORF, "Essential light chain for Myo1p, light chain for Myo2p; stabilizes Myo2p by binding to the neck region; interacts with Myo1p, Iqg1p, and Myo2p to coordinate formation and contraction of the actomyosin ring with targeted membrane deposition" ORGANISM: Saccharomyces cerevisiae S288C (149 aa)
MSATRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLT
LDQITGLIEVNEKELDATTKAKTEDFVKAFQVFDKESTGKVSVGDLRYMLTGLGEKLTDA
EVDELLKGVEVDSNGEIDYKKFIEDVLRQ