Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL089C  from Saccharomyces cerevisiae S288C
>YGL089C|YGL089C MF(ALPHA)2 SGDID:S000003057, Chr VII from 345153-344791, Genome Release 64-1-1, reverse complement, Verified ORF, "Mating pheromone alpha-factor, made by alpha cells; interacts with mating type a cells to induce cell cycle arrest and other responses leading to mating; also encoded by MF(ALPHA)1, which is more highly expressed than MF(ALPHA)2" ORGANISM: Saccharomyces cerevisiae S288C (120 aa)
MKFISTFLTFILAAVSVTASSDEDIAQVPAEAIIGYLDFGGDHDIAFLPFSNATASGLLF
INTTIAEAAEKEQNTTLAKREAVADAWHWLNLRPGQPMYKREANADAWHWLQLKPGQPMY