Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL087C  from Saccharomyces cerevisiae S288C
>YGL087C|YGL087C MMS2 SGDID:S000003055, Chr VII from 346808-346406,346904-346894, Genome Release 64-1-1, reverse complement, Verified ORF, "Ubiquitin-conjugating enzyme variant involved in error-free postreplication repair; forms a heteromeric complex with Ubc13p, an active ubiquitin-conjugating enzyme; cooperates with chromatin-associated RING finger proteins, Rad18p and Rad5p" ORGANISM: Saccharomyces cerevisiae S288C (137 aa)
MSKVPRNFRLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSL
SIDCGPNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHTLRDWKRAYTMETLLLDLRKEM
ATPANKKLRQPKEGETF