Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL080W  from Saccharomyces cerevisiae S288C
>YGL080W|YGL080W FMP37 SGDID:S000003048, Chr VII from 358636-359028, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; highly conserved across species and orthologous to human gene BRP44L; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies" ORGANISM: Saccharomyces cerevisiae S288C (130 aa)
MSQPVQRAAARSFLQKYINKETLKYIFTTHFWGPVSNFGIPIAAIYDLKKDPTLISGPMT
FALVTYSGVFMKYALSVSPKNYLLFGCHLINETAQLAQGYRFLKYTYFTTDEEKKALDKE
WKEKEKTGKQ