Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL070C  from Saccharomyces cerevisiae S288C
>YGL070C|YGL070C RPB9 SGDID:S000003038, Chr VII from 374827-374459, Genome Release 64-1-1, reverse complement, Verified ORF, "RNA polymerase II subunit B12.6; contacts DNA; mutations affect transcription start site selection and fidelity of transcription" ORGANISM: Saccharomyces cerevisiae S288C (122 aa)
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQ
DIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
FS