Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL058W  from Saccharomyces cerevisiae S288C
>YGL058W|YGL058W RAD6 SGDID:S000003026, Chr VII from 393986-394504, Genome Release 64-1-1, Verified ORF, "Ubiquitin-conjugating enzyme (E2), involved in postreplication repair (as a heterodimer with Rad18p), DSBR and checkpoint control (as a heterodimer with Bre1p), ubiquitin-mediated N-end rule protein degradation (as a heterodimer with Ubr1p" ORGANISM: Saccharomyces cerevisiae S288C (172 aa)
MSTPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFD
EEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS
PANVEAATLFKDHKSQYVKRVKETVEKSWEDDMDDMDDDDDDDDDDDDDEAD