Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL054C  from Saccharomyces cerevisiae S288C
>YGL054C|YGL054C ERV14 SGDID:S000003022, Chr VII from 401287-400871, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein localized to COPII-coated vesicles, involved in vesicle formation and incorporation of specific secretory cargo; required for the delivery of bud-site selection protein Axl2p to cell surface; related to Drosophila cornichon" ORGANISM: Saccharomyces cerevisiae S288C (138 aa)
MGAWLFILAVVVNCINLFGQVHFTILYADLEADYINPIELCSKVNKLITPEAALHGALSL
LFLLNGYWFVFLLNLPVLAYNLNKIYNKVQLLDATEIFRTLGKHKRESFLKLGFHLLMFF
FYLYRMIMALIAESGDDF