Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YGL041C-B  from Saccharomyces cerevisiae S288C
>YGL041C-B|YGL041C-B YGL041C-B SGDID:S000028548, Chr VII from 418886-418704, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR" ORGANISM: Saccharomyces cerevisiae S288C (60 aa)
MFDSSIERVTLELCFHITLSIMCGCSIYFLLLVFILTFYSSVLLHLKLYFFSSDRAIFNA