Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL037C  from Saccharomyces cerevisiae S288C
>YGL037C|YGL037C PNC1 SGDID:S000003005, Chr VII from 427947-427297, Genome Release 64-1-1, reverse complement, Verified ORF, "Nicotinamidase that converts nicotinamide to nicotinic acid as part of the NAD(+) salvage pathway, required for life span extension by calorie restriction; PNC1 expression responds to all known stimuli that extend replicative life span" ORGANISM: Saccharomyces cerevisiae S288C (216 aa)
MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISF
AKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIV
DKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGY
KTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK