Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL032C  from Saccharomyces cerevisiae S288C
>YGL032C|YGL032C AGA2 SGDID:S000003000, Chr VII from 436833-436570, Genome Release 64-1-1, reverse complement, Verified ORF, "Adhesion subunit of a-agglutinin of a-cells, C-terminal sequence acts as a ligand for alpha-agglutinin (Sag1p) during agglutination, modified with O-linked oligomannosyl chains, linked to anchorage subunit Aga1p via two disulfide bonds" ORGANISM: Saccharomyces cerevisiae S288C (87 aa)
MQLLRCFSIFSVIASVLAQELTTICEQIPSPTLESTPYSLSTTTILANGKAMQGVFEYYK
SVTFVSNCGSHPSTTSKGSPINTQYVF