Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL030W  from Saccharomyces cerevisiae S288C
>YGL030W|YGL030W RPL30 SGDID:S000002998, Chr VII from 439091-439093,439324-439638, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to rat L30 ribosomal protein; involved in pre-rRNA processing in the nucleolus; autoregulates splicing of its transcript" ORGANISM: Saccharomyces cerevisiae S288C (105 aa)
MAPVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYA
MLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA