Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL029W  from Saccharomyces cerevisiae S288C
>YGL029W|YGL029W CGR1 SGDID:S000002997, Chr VII from 440063-440425, Genome Release 64-1-1, Verified ORF, "Protein involved in nucleolar integrity and processing of the pre-rRNA for the 60S ribosome subunit; transcript is induced in response to cytotoxic stress but not genotoxic stress" ORGANISM: Saccharomyces cerevisiae S288C (120 aa)
MVNETGESQKAAKGTPVSGKVWKAEKTPLRAKSRVVKNKKLTSWELKKQKRLEDKQFKER
LKALKDEKEEARQAKITMLKERREKKEENERYERLAAKMHAKKVERMRRREKRNKALKER