Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL015C  from Saccharomyces cerevisiae S288C
>YGL015C|YGL015C YGL015C SGDID:S000002983, Chr VII from 465435-465043, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; null mutants accumulate cargo in the Golgi" ORGANISM: Saccharomyces cerevisiae S288C (130 aa)
MEDTIRPLNYADIETSGPINLLETTNNLKSSLKKFSQKAKGSHISRERIHHFRKWKNKTE
SLSENHLKPPPDVDSLCFSNCFQPDALSGNVFLPPRSSNMYWNEKQLQLEMEILKFLSLN
TSNECCTSDD