Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YGL006W-A  from Saccharomyces cerevisiae S288C
>YGL006W-A|YGL006W-A YGL006W-A SGDID:S000028769, Chr VII from 485423-485533, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by SAGE" ORGANISM: Saccharomyces cerevisiae S288C (36 aa)
MLIFIIHYHRHLALHLMGAFQKHSNSISPPPRKGFI