Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YGL002W  from Saccharomyces cerevisiae S288C
>YGL002W|YGL002W ERP6 SGDID:S000002970, Chr VII from 494517-495167, Genome Release 64-1-1, Verified ORF, "Protein with similarity to Emp24p and Erv25p, member of the p24 family involved in ER to Golgi transport; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies" ORGANISM: Saccharomyces cerevisiae S288C (216 aa)
MLSHYIFLAFVLLPFRVSAFYFYGYGGDRKCFLKELSKDTLLKGSYNLEVYDDKLADYAL
PSYNDYGIVIDVEEVFDNNHRVVHQQGSPSGDFSFLALESGEYKICLQSRVNNWVGKTKT
KLEIEFEVGFEAMLDMQRKETLESLHGKVSILNSKIVDIRREQQLMREREESFRDISESV
NSRAMWWTVTQVTLLIIICVWQMKSLRSFFVKQKVL