Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YFR049W  from Saccharomyces cerevisiae S288C
>YFR049W|YFR049W YMR31 SGDID:S000001945, Chr VI from 248523-248894, Genome Release 64-1-1, Verified ORF, "Mitochondrial ribosomal protein of the small subunit, has similarity to human mitochondrial ribosomal protein MRP-S36" ORGANISM: Saccharomyces cerevisiae S288C (123 aa)
MIATPIRLAKSAYEPMIKFVGTRHPLVKHATEVVVHPCATNGMLPGSKECIPVSKFMENY
KPFRVVPIKHSANAGLSSSKTSVFVNRPLQKDELASIFELPARFRYKPINEHELESINSG
GAW