Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YFR036W  from Saccharomyces cerevisiae S288C
>YFR036W|YFR036W CDC26 SGDID:S000001932, Chr VI from 226963-227337, Genome Release 64-1-1, Verified ORF, "Subunit of the Anaphase-Promoting Complex/Cyclosome (APC/C), which is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition" ORGANISM: Saccharomyces cerevisiae S288C (124 aa)
MIRRAPTTLQLSHDDVTSLIDDLNEQKLKQQLNIEKTKYFQGKNGGSLHSNTDFQDTSQN
IEDNNNDNDNDIDEDDDMSSYNDKAASVAHTRVLNSLHLSTDSNTAHETSNANDNHNPFY
IREE