Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YFR035C  from Saccharomyces cerevisiae S288C
>YFR035C|YFR035C YFR035C SGDID:S000001931, Chr VI from 226465-226121, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function, deletion mutant exhibits synthetic phenotype with alpha-synuclein" ORGANISM: Saccharomyces cerevisiae S288C (114 aa)
MSASDKTKLCNKGMSRTSRTTTFVITPAFRERDDEGANSLCKAFLNTFSNLKSGMFKCLL
GVGAVGTFISTFPQFFLLPCLLCVRCVCVCLCASISYAASAIFSFSIFFFFCLA