Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YFR032C-B  from Saccharomyces cerevisiae S288C
>YFR032C-B|YFR032C-B YFR032C-B SGDID:S000028630, Chr VI from 223973-223710, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (87 aa)
MVASRARENQRYSQCRKSTIFPLGFAIISGYIQFQNISILHISRFNPLFYNIFHSIFKNP
GTTIQLESTLYYHEVPISPIGNAGSQI