>YFR032C-A|YFR032C-A RPL29 SGDID:S000006437, Chr VI from 223437-223258, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to rat L29 ribosomal protein; not essential for translation, but required for proper joining of the large and small ribosomal subunits and for normal translation rate" ORGANISM: Saccharomyces cerevisiae S288C (59 aa)
MAKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHALHGTAKALAAAKK