Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YFR011C  from Saccharomyces cerevisiae S288C
>YFR011C|YFR011C AIM13 SGDID:S000001907, Chr VI from 167258-166746, Genome Release 64-1-1, reverse complement, Verified ORF, "Putative protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria; null mutant displays reduced respiratory growth and reduced frequency of mitochondrial genome loss" ORGANISM: Saccharomyces cerevisiae S288C (170 aa)
MGSNTSKVGAGAEKQQVYTPLTQIDFSQSLVSQLDSSKESDYVTKQNAEKFIEKKVSQRL
SNLEVETLKKFEDTLNNSLLSDDDKDAVDGISSSSLNNQIESLNKKLTLFDQLELQKLEK
YGGAKGKSDKKTDNGSISIKAKLTECLLANKGKPLNCYEEMEEFKKLVMG