Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YFR003C  from Saccharomyces cerevisiae S288C
>YFR003C|YFR003C YPI1 SGDID:S000001899, Chr VI from 153124-152657, Genome Release 64-1-1, reverse complement, Verified ORF, "Inhibitor of the type I protein phosphatase Glc7p, which is involved in regulation of a variety of metabolic processes; overproduction causes decreased cellular content of glycogen" ORGANISM: Saccharomyces cerevisiae S288C (155 aa)
MSGNQMAMGSEQQQTVGSRTVSVEEVPAVLQLRATQDPPRSQEAMPTRHNVRWEENVIDN
ENMNKKKTKICCIFHPQNEDEEECNHHSDDDGSSSSGSSSSESENEKDLDFNERRQRRLE
RRHRKLEKKRSYSPNAYEIQPDYSEYRRKQQEKKD