Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YFL065C  from Saccharomyces cerevisiae S288C
>YFL065C|YFL065C YFL065C SGDID:S000001829, Chr VI from 3338-3030, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; induced by treatment with 8-methoxypsoralen and UVA irradiation" ORGANISM: Saccharomyces cerevisiae S288C (102 aa)
MRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPHMFLLLHVDELSIFSAYQASLPGEKKVDT
ERLKRDLCPRKPIEIKYFSQICNDMMNKKDRLGDVLRVCCPS