Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YFL057C  from Saccharomyces cerevisiae S288C
>YFL057C|YFL057C AAD16 SGDID:S000001837, Chr VI from 14763-14305, Genome Release 64-1-1, reverse complement, Verified ORF, "Putative aryl-alcohol dehydrogenase; similar to P. chrysosporium aryl-alcohol dehydrogenase; mutational analysis has not yet revealed a physiological role" ORGANISM: Saccharomyces cerevisiae S288C (152 aa)
MARHFGMALAPWDVMGGGRFQSKKAMEERRKNGEGIRSFVGASEQTDAEIKISEALAKVA
EEHGTESVTAIAIAYVRSKAKNVFPLVGGRKIEHLKQNIEALSIKLTPEQIKYLESIIPF
DVGFPTNFIGDDPAVTKKASLLTAMSAQISFD