Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YFL038C  from Saccharomyces cerevisiae S288C
>YFL038C|YFL038C YPT1 SGDID:S000001856, Chr VI from 55986-55366, Genome Release 64-1-1, reverse complement, Verified ORF, "Rab family GTPase, involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by protein geranylgeranyltransferase type II (Bet2p-Bet4p)" ORGANISM: Saccharomyces cerevisiae S288C (206 aa)
MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQ
IWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVG
NKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNE
TTQKKEDKGNVNLKGQSLTNTGGGCC