Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YFL034C-A  from Saccharomyces cerevisiae S288C
>YFL034C-A|YFL034C-A RPL22B SGDID:S000006436, Chr VI from 64599-64243,64932-64921, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl22Ap and to rat L22 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (122 aa)
MAPNTSRKQKVIKTLTVDVSSPTENGVFDPASYSKYLIDHIKVDGAVGNLGNAIEVTEDG
SIVTVVSSAKFSGKYLKYLTKKYLKKNQLRDWIRFVSIRQNQYKLVFYQVTPEDADEEED
DE