Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YFL020C  from Saccharomyces cerevisiae S288C
>YFL020C|YFL020C PAU5 SGDID:S000001874, Chr VI from 99599-99231, Genome Release 64-1-1, reverse complement, Verified ORF, "Member of the seripauperin multigene family encoded mainly in subtelomeric regions; induced during alcoholic fermentation; induced by low temperature and also by anaerobic conditions; negatively regulated by oxygen and repressed by heme" ORGANISM: Saccharomyces cerevisiae S288C (122 aa)
MVKLTSIAAGVAAIAAGASAAATTTLSQSDERVNLVELGVYVSDIRAHLAEYYSFQAAHP
TETYPVEIAEAVFNYGDFTTMLTGIPADQVTRVITGVPWYSSRLKPAISSALSADGIYTI
AN