Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YFL017W-A  from Saccharomyces cerevisiae S288C
>YFL017W-A|YFL017W-A SMX2 SGDID:S000002965, Chr VI from 103699-103932, Genome Release 64-1-1, Verified ORF, "Core Sm protein Sm G; part of heteroheptameric complex (with Smb1p, Smd1p, Smd2p, Smd3p, Sme1p, and Smx3p) that is part of the spliceosomal U1, U2, U4, and U5 snRNPs; homolog of human Sm G" ORGANISM: Saccharomyces cerevisiae S288C (77 aa)
MVSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINGEDPANNHQLGLQ
TVIRGNSIISLEALDAI