Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YFL017C  from Saccharomyces cerevisiae S288C
>YFL017C|YFL017C GNA1 SGDID:S000001877, Chr VI from 104462-103983, Genome Release 64-1-1, reverse complement, Verified ORF, "Evolutionarily conserved glucosamine-6-phosphate acetyltransferase required for multiple cell cycle events including passage through START, DNA synthesis, and mitosis; involved in UDP-N-acetylglucosamine synthesis, forms GlcNAc6P from AcCoA" ORGANISM: Saccharomyces cerevisiae S288C (159 aa)
MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATVWNDNEDKKIM
QYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLV
TIGFDYGCYKIILDCDEKNVKFYEKCGFSNAGVEMQIRK