Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YFL014W  from Saccharomyces cerevisiae S288C
>YFL014W|YFL014W HSP12 SGDID:S000001880, Chr VI from 107256-107585, Genome Release 64-1-1, Verified ORF, "Plasma membrane protein involved in maintaining membrane organization in stress conditions; induced by heat shock, oxidative stress, osmostress, stationary phase, glucose depletion, oleate and alcohol; regulated by HOG and Ras-Pka pathways" ORGANISM: Saccharomyces cerevisiae S288C (109 aa)
MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDSA
EKGKDNAEGQGESLADQARDYMGAAKSKLNDAVEYVSGRVHGEEDPTKK