Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YFL012W  from Saccharomyces cerevisiae S288C
>YFL012W|YFL012W YFL012W SGDID:S000001882, Chr VI from 110647-111093, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; transcribed during sporulation; null mutant exhibits increased resistance to rapamycin" ORGANISM: Saccharomyces cerevisiae S288C (148 aa)
MPKSRPKRTIASSSSVFYGSSPFQNDGYIKVMELVSHIVIEINHSPTATTDETRKQNNPE
LKVKEPVCNLKKWENNTNFILEDHTKNKTKLSSTDRIRKWFRRHILKEEIEILSHGKQLS
SIDEDYCPSNVLVGCSRDLNKLRSFQNF