Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YFL010W-A  from Saccharomyces cerevisiae S288C
>YFL010W-A|YFL010W-A AUA1 SGDID:S000001955, Chr VI from 114990-115274, Genome Release 64-1-1, Verified ORF, "Protein required for the negative regulation by ammonia of Gap1p, which is a general amino acid permease" ORGANISM: Saccharomyces cerevisiae S288C (94 aa)
MDRSLQVYICMYPYLDGSKQYRFDELISFYRPCPKSLDNIKSHYRQIHHQIRRRTHQHHQ
IRRRTHQHHHRSNCSRQRQCLVRHSCGRQMRVLA