Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YFL010C  from Saccharomyces cerevisiae S288C
>YFL010C|YFL010C WWM1 SGDID:S000001884, Chr VI from 115743-115108, Genome Release 64-1-1, reverse complement, Verified ORF, "WW domain containing protein of unknown function; binds to Mca1p, a caspase-related protease that regulates H2O2-induced apoptosis; overexpression causes G1 phase growth arrest and clonal death that is suppressed by overexpression of MCA1" ORGANISM: Saccharomyces cerevisiae S288C (211 aa)
MAQSKSNPPQVPSGWKAVFDDEYQTWYYVDLSTNSSQWEPPRGTTWPRPKGPPPGVNNEK
SSRQQADQAPPPYSSQSTPQVQAGAQAQQPRYYQPQQPQYPQYPQQQRYYPQQAPMPAAA
PQQAYYGTAPSTSKGSGHGGAMMGGLLGVGAGLLGGAMLEHAFDDHNYDGPDTVVVENNY
YGDDAGGSDGGFDDAGGFDGGFDDGFDGSDF