Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YFL005W  from Saccharomyces cerevisiae S288C
>YFL005W|YFL005W SEC4 SGDID:S000001889, Chr VI from 130334-130981, Genome Release 64-1-1, Verified ORF, "Rab family GTPase essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane" ORGANISM: Saccharomyces cerevisiae S288C (215 aa)
MSGLRTVSASSGNGKSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIK
TVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNE
HANDEAQLLLVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLI
QEKIDSNKLVGVGNGKEGNISINSGSGNSSKSNCC