Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YER175W-A  from Saccharomyces cerevisiae S288C
>YER175W-A|YER175W-A YER175W-A SGDID:S000028625, Chr V from 540650-540814, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (54 aa)
MRLHKTFICFSQNKRGCRNILQENSRMIFENKILIMILRQGIFFNISVSTKISF