Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER170W  from Saccharomyces cerevisiae S288C
>YER170W|YER170W ADK2 SGDID:S000000972, Chr V from 525974-526651, Genome Release 64-1-1, Verified ORF, "Mitochondrial adenylate kinase, catalyzes the reversible synthesis of GTP and AMP from GDP and ADP; may serve as a back-up for synthesizing GTP or ADP depending on metabolic conditions; 3' sequence of ADK2 varies with strain background" ORGANISM: Saccharomyces cerevisiae S288C (225 aa)
MKADAKQITHLLKPLRLLLLGAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSESTL
GREATTYIAQGKLLPDDLITRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQ
HDASLNLVVELDVPESTILERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLD
DTAEVFKKRLEEYKKTNEPLKDYYKKSGIFGTVSGETSDIIFRNY