Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER159C  from Saccharomyces cerevisiae S288C
>YER159C|YER159C BUR6 SGDID:S000000961, Chr V from 491958-491530, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of a heterodimeric NC2 transcription regulator complex with Ncb2p; complex binds to TBP and can repress transcription by preventing preinitiation complex assembly or stimulate activated transcription; homologous to human NC2alpha" ORGANISM: Saccharomyces cerevisiae S288C (142 aa)
MADQVPVTTQLPPIKPEHEVPLDAGGSPVGNMGTNSNNNNELGDVFDRIKTHFPPAKVKK
IMQTDEDIGKVSQATPVIAGRSLEFFIALLVKKSGEMARGQGTKRITAEILKKTILNDEK
FDFLREGLCVEEGQTQPEEESA