Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YER150W  from Saccharomyces cerevisiae S288C
>YER150W|YER150W SPI1 SGDID:S000000952, Chr V from 468370-468816, Genome Release 64-1-1, Verified ORF, "GPI-anchored cell wall protein involved in weak acid resistance; basal expression requires Msn2p/Msn4p; expression is induced under conditions of stress and during the diauxic shift; similar to Sed1p" ORGANISM: Saccharomyces cerevisiae S288C (148 aa)
MLSNAKLLLSLAMASTALGLVSNSSSSVIVVPSSDATIAGNDTATPAPEPSSAAPIFYNS
TATATQYEVVSEFTTYCPEPTTFVTNGATFTVTAPTTLTITNCPCTIEKPTSETSVSSTH
DVETNSNAANARAIPGALGLAGAVMMLL